Accéder au contenu
Merck
Toutes les photos(8)

Principaux documents

WH0057154M1

Sigma-Aldrich

Monoclonal Anti-SMURF1 antibody produced in mouse

clone 1D7, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-KIAA1625, Anti-SMAD specific E3 ubiquitin protein ligase 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
427.00 CHF

427.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μG
427.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

427.00 CHF


Check Cart for Availability

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1D7, monoclonal

Forme

buffered aqueous solution

Espèces réactives

rat, mouse, human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SMURF1(57154)

Description générale

SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) is an E3 ubiquitin ligase and the gene encoding it is localized on human chromosome 7q22.1.

Immunogène

SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP

Application

Monoclonal Anti-SMURF1 antibody produced in mouse has been used in Western Blotting.

Actions biochimiques/physiologiques

SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) acts as a negative regulator of transforming growth factor β (TGFβ) pathway. It has a role in the nuclear export of mothers against decapentaplegic homolog 7 (SMAD7) and the degradation of SMAD4. During epithelial-mesenchymal transition, SMURF1 dissolves tight junctions in cells. This protein also has a role in cell migration and in the bone morphogenetic protein pathway. SMURF1 has been associated with hepatocellular carcinoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

SMURF1 amplification promotes invasiveness in pancreatic cancer.
Kwei KA
PLoS ONE (2011)
Peroxisomal protein PEX13 functions in selective autophagy
Ming Y Lee
EMBO Reports (2016)
Immunolocalization of Smurf1 in Hirano bodies.
Makioka K
Journal of the Neurological Sciences (2014)
Ning Zhang et al.
Journal of clinical and translational hepatology, 12(3), 227-235 (2024-03-01)
Liver iron overload can induce hepatic expression of bone morphogenic protein (BMP) 6 and activate the BMP/SMAD pathway. However, serum iron overload can also activate SMAD but does not induce BMP6 expression. Therefore, the mechanisms through which serum iron overload
Smurf1 controls S phase progression and tumorigenesis through Wee1 degradation.
Wei R
Febs Letters (2017)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique