This product is a mixture of 22 peptides derived from the post-trypsin digest of QCAL. This is a lyophilized powder. Upon reconstitution with an appropriate solvent - typically 0.1% formic or trifluoroacetic acid in water - the solution is injection-ready. Please see the link below to review the product technical bulletin for further instructions for use:
https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/827/937/msqc2dat.pdf
MSQC2
MS QCAL Peptide Mix
lyophilized powder
Synonyme(s) :
MS Qual/Quant QC Mix, universal MS platform standard
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Sélectionner une taille de conditionnement
2 X 25 μG
339.00 CHF
Sélectionner une taille de conditionnement
Changer de vue
2 X 25 μG
339.00 CHF
About This Item
Code UNSPSC :
12352200
Nomenclature NACRES :
NA.24
Produits recommandés
Forme
lyophilized powder
Classe(s) chimique(s) de l'analyte
amino acids, peptides, proteins
Technique(s)
HPLC: suitable
Application(s)
food and beverages
Format
multi-component solution
Conditions d'expédition
ambient
Température de stockage
2-8°C
Vous recherchez des produits similaires ? Visite Guide de comparaison des produits
Description générale
QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli. The parent protein sequence of QCAL is as follows:
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
Application
MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.
This product is optimized to assess platform characteristics, including:
- Repeatability/Reproducibility between runs
- System stability (drift, chromatography, signal intensity, sensitivity, etc.)
- Inter- and intra- platform and lab comparisons
Caractéristiques et avantages
General
Complexity
Complexity
- Defined mixture gives confidence in your instruments analysis
Composants
Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Les clients ont également consulté
Claire E Eyers et al.
Journal of the American Society for Mass Spectrometry, 19(9), 1275-1280 (2008-07-05)
If proteome datasets are to be collated, shared, and merged for higher level proteome analyses, there is a need for generally accepted strategies and reagents for optimization and standardization of instrument performance. At present, there is no single protein or
Julie M Pratt et al.
Nature protocols, 1(2), 1029-1043 (2007-04-05)
An important area of proteomics involves the need for quantification, whether relative or absolute. Many methods now exist for relative quantification, but to support biomarker proteomics and systems biology, absolute quantification rather than relative quantification is required. Absolute quantification usually
-
1. I would like to clarify whether this peptide quantity is based on the mass of the E.coli protein before trypsinization. 2. Is this product LC-MS injection-ready? 3. Please provide the protocol for this product.
1 answer-
Helpful?
-
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique
