HPA010574

Anti-SYT4 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-HsT1192, Anti-KIAA1342, Anti-synaptotagmin IV
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA010574
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: SNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMT
• Numéro d'accès UniProt: Q9H2B2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SYT4(6860)

Description

Description générale

SYT4 (synaptotagmin 4) gene is localized on human chromosome 18q12.3. Its mRNA is predominantly expressed in hippocampus of human brain, and shows lesser expression in amygdala and thalamus. This protein is a member of the SYT protein family. In PC12 (pheochromocytoma) cell line, it is expressed in endoplasmic reticulum-Golgi complexes and secretory granules. In culture neurons, this protein localizes to axonal processes. This protein forms a part of neuroendocrine system.

Immunogène

synaptotagmin IV recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

SYT4 (synaptotagmin 4) protein is thought to play a role in human brain functioning and neurological disorders. SYT4 null mice die shortly after birth. It is an atypical regulator of synaptic exocytosis, and also negatively controls the exocytosis of oxytocin. In dietary obesity, there is an increased vesicle binding of SYT4, which leads to increased negative regulation of oxytocin exocytosis.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71943

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable