The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
https://www.uniprot.org/uniprotkb/P01133/entry
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
E9644
Epidermal Growth Factor, human
≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
Synonyme(s) :
Facteur de croissance épidermique human, EGF
Sélectionner une taille de conditionnement
315.00 CHF
Date d'expédition estimée le14 mars 2025
Sélectionner une taille de conditionnement
About This Item
315.00 CHF
Date d'expédition estimée le14 mars 2025
Produits recommandés
product name
EGFh, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture
Source biologique
human
Niveau de qualité
Produit recombinant
expressed in E. coli
Pureté
≥97% (SDS-PAGE)
Forme
lyophilized powder
Puissance
0.08-0.8 ng/mL ED50/EC50
Poids mol.
~6 kDa
Conditionnement
pkg of 5X0.2 mg
pkg of 0.2 mg
pkg of 0.5 mg
Conditions de stockage
avoid repeated freeze/thaw cycles
Technique(s)
cell culture | mammalian: suitable
Impuretés
≤1 EU/μg endotoxin (EGF)
Couleur
white
Solubilité
water: soluble, clear, colorless
Numéro d'accès UniProt
Température de stockage
−20°C
Informations sur le gène
human ... EGF(1950)
Vous recherchez des produits similaires ? Visite Guide de comparaison des produits
Application
Actions biochimiques/physiologiques
Les fonctions cellulaires affectées par l′EGF sont : la mitose, le flux ionique, le transport du glucose, la glycolyse, la synthèse d′acides nucléiques et de protéines, la survie, la croissance, la prolifération et la différenciation.
Les effet biologiques de l′EGF sont : l′inhibition de la sécrétion d′acide gastrique, la croissance et le développement fœtaux, ainsi que la neuromodulation du système nerveux central.
Les voies affectées par l′EGF sont : la signalisation EGFR, la cascade MAPK, la signalisation Ca2+ et PIP.
Composants
Attention
Notes préparatoires
Remarque sur l'analyse
Code de la classe de stockage
11 - Combustible Solids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, type N95 (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Les clients ont également consulté
Articles
Human pancreatic cancer organoid biobank (PDAC organoids) with various KRAS mutations to aide in 3D cell culture and cancer research applications.
Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com
Organoid culture products to generate tissue and stem cell derived 3D brain, intestinal, gut, lung and cancer tumor organoid models.
Protocoles
A stem cell culture protocol to generate 3D NSC models of Alzheimer’s disease using ReNcell human neural stem cell lines.
Step-by-step culture protocols for neural stem cell culture including NSC isolation, expansion, differentiation and characterization.
Contenu apparenté
Monitor barrier formation using colon PDOs, iPSC-derived colon organoids, Millicell® cell culture inserts, and the Millicell® ERS. 3.0.
-
what is the full peptide sequence of mature E9644 protein (~6kD)?
1 answer-
Helpful?
-
-
For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?
1 answer-
After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.
Helpful?
-
-
What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
The mature protein has a molecular weight of 6 kD.
Helpful?
-
-
Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?
1 answer-
This product has been tested for activity using the mouse Balb/3T3 cell line. We have not tested its activity in rat cell culture, but we expect that will also work in that application.
Helpful?
-
-
Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
We recommend reconstitution with acetic acid to make sure the entire product will be solubilized. PBS can be used, but the total amount of the protein in the vial may not go into solution. It is best to make a higher concentration in acetic acid, and then dilute into PBS.
Helpful?
-
-
What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?
1 answer-
Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
-
How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?
1 answer-
Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.
Helpful?
-
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique