Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

E9644

Sigma-Aldrich

Epidermal Growth Factor, human

≥97% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture

Synonyme(s) :

Facteur de croissance épidermique human, EGF

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

0.2 MG
315.00 CHF
0.5 MG
485.00 CHF
5 X .2 MG
1 180.00 CHF

315.00 CHF


Date d'expédition estimée le14 mars 2025



Sélectionner une taille de conditionnement

Changer de vue
0.2 MG
315.00 CHF
0.5 MG
485.00 CHF
5 X .2 MG
1 180.00 CHF

About This Item

Numéro CAS:
Numéro MDL:
Code UNSPSC :
12352202
Nomenclature NACRES :
NA.77

315.00 CHF


Date d'expédition estimée le14 mars 2025


product name

EGFh, EGF, recombinant, expressed in E. coli, lyophilized powder, suitable for cell culture

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in E. coli

Pureté

≥97% (SDS-PAGE)

Forme

lyophilized powder

Puissance

0.08-0.8 ng/mL ED50/EC50

Poids mol.

~6 kDa

Conditionnement

pkg of 5X0.2 mg
pkg of 0.2 mg
pkg of 0.5 mg

Conditions de stockage

avoid repeated freeze/thaw cycles

Technique(s)

cell culture | mammalian: suitable

Impuretés

≤1 EU/μg endotoxin (EGF)

Couleur

white

Solubilité

water: soluble, clear, colorless

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... EGF(1950)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Application

Ce produit est utilisé comme mitogène pour déclencher la mitose dans diverses lignées cellulaires. Dans les cultures tissulaires, l′EGF permet de réduire le besoin en sérum voire de s′en affranchir totalement, et peut être employé parallèlement aux hormones et aux autres additifs pour milieu.[1][2][3][4][5]

Actions biochimiques/physiologiques

Le facteur de croissance épidermique (EGF) est un petit polypeptide mitogénique présent dans un grand nombre de tissus et de fluides corporels de nombreux mammifères. L′EGF fait partie d′une famille de facteurs de croissance caractérisée par six motifs cystéine conservés formant trois ponts disulfure. L′EGF a un effet mitogénique sur diverses cellules épidermiques et épithéliales, notamment les fibroblastes, les cellules gliales, les cellules endothéliales vasculaires et cornéennes, les cellules de la granulosa bovine, les cellules HeLa, les cellules SV40-3T3 et les cellules épithéliales mammaires.
Les fonctions cellulaires affectées par l′EGF sont : la mitose, le flux ionique, le transport du glucose, la glycolyse, la synthèse d′acides nucléiques et de protéines, la survie, la croissance, la prolifération et la différenciation.
Les effet biologiques de l′EGF sont : l′inhibition de la sécrétion d′acide gastrique, la croissance et le développement fœtaux, ainsi que la neuromodulation du système nerveux central.
Les voies affectées par l′EGF sont : la signalisation EGFR, la cascade MAPK, la signalisation Ca2+ et PIP.

Composants

L′EGF humain (EGFh) est identique à l′urogastrone β, une molécule isolée sur la base de sa capacité à inhiber la sécrétion d′acide gastrique. L′EGF est un homologue structural du facteur de croissance transformant α, et tous deux agissent via les récepteurs de l′EGF. L′E9644 est la forme à méthionyle N-terminal de l′EGF mature naturel.

Attention

Conserver le produit à -20 °C. À cette température, l′activité est maintenue pendant deux ans. Après reconstitution, le produit peut être stocké un mois entre 2 et 8 °C, ou congelé en aliquotes à -70 °C ou -20 °C pour des durées plus longues.

Notes préparatoires

Ce produit est issu de la lyophilisation d′une solution saline tamponnée au phosphate à pH 7,4 filtrée sur un filtre de 0,2 μm. Ce produit doit être reconstitué en dissolvant le contenu du flacon dans de l′acide acétique 10 mM pour atteindre une concentration de 1 mg/ml. Pour obtenir une dilution de concentration inférieure (sans aller en-deçà de 10 μg/ml), il est nécessaire d′ajouter 0,1 % d′albumine de sérum bovin ou humain. Pour procéder à un essai de prolifération, diluer de nouveau l′échantillon à l′aide d′un milieu exempt d′albumine.

Remarque sur l'analyse

L′activité biologique de ce produit est mesurée dans un essai de prolifération à l′aide de cellules BALB/MK. La CE50 est définie comme la concentration efficace en facteur de croissance qui provoque une hausse de 50 % de la croissance cellulaire dans un essai biologique sur des cellules.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, type N95 (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Anita Alexa et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(9), 2711-2716 (2015-03-03)
Mitogen-activated protein kinases (MAPKs) bind and activate their downstream kinase substrates, MAPK-activated protein kinases (MAPKAPKs). Notably, extracellular signal regulated kinase 2 (ERK2) phosphorylates ribosomal S6 kinase 1 (RSK1), which promotes cellular growth. Here, we determined the crystal structure of an
Piera Versura et al.
Investigative ophthalmology & visual science, 52(8), 5488-5496 (2011-04-19)
To investigate the immune response of human conjunctival epithelium to hyperosmolar stress. Tear osmolarity was measured in 15 normal subjects and 25 dry eye (DE) patients; conjunctival imprint cytology samples were obtained at the nasal bulbar area. Subconfluent primary human
Koji Teramoto et al.
Cellular signalling, 62, 109329-109329 (2019-06-04)
EphA2, which belongs to the Eph family of receptor tyrosine kinases, is overexpressed in a variety of human cancers. Serine 897 (S897) phosphorylation of EphA2 is known to promote cancer cell migration and proliferation in a ligand-independent manner. In this
Hossein Baharvand et al.
Molecular vision, 13, 1711-1721 (2007-10-26)
A new strategy of treating ocular surface reconstruction is to transplant a bioengineered graft by expanding limbal stem cells (SCs) ex vivo on the amniotic membrane (AM). The reasons for the exceptional success on the AM are not fully understood
Marzeih Ebrahimi et al.
Molecular vision, 16, 1680-1688 (2010-09-02)
The aim of this study is to create an ex vivo model to examine the expression of major heat-shock protein (HSP) families; HSP60, HSP72, and HSP90, and heat-shock cognate 70 (HCS70) at the mRNA and protein level in differentiating corneal

Articles

Human pancreatic cancer organoid biobank (PDAC organoids) with various KRAS mutations to aide in 3D cell culture and cancer research applications.

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Organoid culture products to generate tissue and stem cell derived 3D brain, intestinal, gut, lung and cancer tumor organoid models.

Protocoles

A stem cell culture protocol to generate 3D NSC models of Alzheimer’s disease using ReNcell human neural stem cell lines.

Step-by-step culture protocols for neural stem cell culture including NSC isolation, expansion, differentiation and characterization.

Contenu apparenté

Monitor barrier formation using colon PDOs, iPSC-derived colon organoids, Millicell® cell culture inserts, and the Millicell® ERS. 3.0.

Questions

1–8 of 8 Questions  
  1. what is the full peptide sequence of mature E9644 protein (~6kD)?

    1 answer
    1. The human EFG is synthesized as a long preproprotein of 1207 amino acids. The bioactive fragment (from amino acids 970 to 1023) is released by proteolytic cleavage. Please see the sequence below as well as the link to the Uniprot profile:
      https://www.uniprot.org/uniprotkb/P01133/entry
      NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

      Helpful?

  2. For the reconstitution in 10mM acetic acid and 0.1%BSA, do you use PBS or H20 for the rest of the solution?

    1 answer
    1. After the material is reconstituted in 10mM acetic acid, the material can be aliquoted and stored at 2-8°C for one month, or frozen in aliquots at -70°C or -20°C for longer periods. If the stock solution is very dilute, at a concentration less than 10 ug/mL, then BSA or HSA should be added to a concentration of 0.1% in the acetic acid solution prior to reconstitution in order to maintain the stability of the product.

      Helpful?

  3. What is the molecular weight of Epidermal Growth Factor (EGF) human, Product E9644?

    1 answer
    1. The mature protein has a molecular weight of 6 kD.

      Helpful?

  4. Can Epidermal Growth Factor (EGF) human, Product E9644, be used on rat cells?

    1 answer
    1. This product has been tested for activity using the mouse Balb/3T3 cell line.  We have not tested its activity in rat cell culture, but we expect that will also work in that application.

      Helpful?

  5. Can I use PBS to reconstitute Epidermal Growth Factor (EGF) human, Product E9644?

    1 answer
    1. We recommend reconstitution with acetic acid to make sure the entire product will be solubilized.  PBS can be used, but the total amount of the protein in the vial may not go into solution.  It is best to make a higher concentration in acetic acid, and then dilute into PBS.

      Helpful?

  6. What is the difference between Product No. E9644 and E4269, Epidermal Growth Factor?

    1 answer
    1. Product No. E9644 is the mature EGF protein. Long EGF (Product No. E4269) is an analog of epidermal growth factor comprising the human EGF amino acid sequence plus a 53 amino acid N-terminal extension peptide. Long EGF has been developed as an inexpensive, high quality potent analog of EGF for use as a growth factor supplement for serum-free or low-serum cell culture.

      Helpful?

  7. What is the Department of Transportation shipping information for this product?

    1 answer
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

  8. How long can I store a solution of Epidermal Growth Factor (EGF) human, Product E9644?

    1 answer
    1. Solution stability can be found on the product data sheet. If Product No. E9644 has been reconstituted with 0.2 micron-filtered 10 mM acetic acid containing 0.1% HSA or BSA to a concentration of not less than 10 ug/ml, it can be stored at 2-8 °C for a maximum of one month. For extended storage, freeze in working aliquots at -70 °C or -20 °C. Repeated freezing and thawing is not recommended.

      Helpful?

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique