WH0164832M1

Monoclonal Anti-LONRF2 antibody produced in mouse

clone 1C7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-FLJ45273, Anti-LON peptidase N-terminal domain and ring finger 2, Anti-MGC126711, Anti-MGC126713, Anti-RNF192
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1C7, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_198461
• UniProt-Hinterlegungsnummer: Q1L5Z9
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... LONRF2(164832)

Beschreibung

Allgemeine Beschreibung

The gene encoding LON peptidase N-terminal domain and ring finger 2 (LONRF2) is localized on human chromosome 2q11.2.

Immunogen

LONRF2 (NP_940863, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA

Biochem./physiol. Wirkung

LON peptidase N-terminal domain and ring finger 2 (LONRF2) has been linked to auto-immune diseases like rhematoid arthritis.

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)