WH0003843M1

Monoclonal Anti-RANBP5 antibody produced in mouse

clone 1C4, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-IMB3, Anti-IPO5, Anti-KPNB3, Anti-MGC2068, Anti-RAN binding protein 5
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1C4, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• GenBank-Hinterlegungsnummer: BC001497
• UniProt-Hinterlegungsnummer: O00410
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... IPO5(3843)

Beschreibung

Allgemeine Beschreibung

IPO5 (importin 5) is a member of the importin β superfamily of transport receptors. It is a Ran-binding protein which is also termed as RanBP5, importin β3 and karyopherin β3 (KPNB3). IPO5 is mostly present in the cytoplasm. This gene is located on human chromosome 13q32.

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. (provided by RefSeq)

Immunogen

RANBP5 (AAH01497, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME

Biochem./physiol. Wirkung

IPO5 (importin 5) is required for the life cycle of influenza A virus and human papillomavirus-16 as it transports specific viral proteins into the nucleus. It act as the trans -acting factor to promote the nuclear translocation of CPEB3 (cytoplasmic polyadenylation element-binding protein) in NMDA-treated (N -methyl-D-aspartate) neurons. Overexpression and alternative splicing of the IPO5 gene is expected to participate in the pathophysiology of schizophrenia.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)