WH0001906M1

Monoclonal Anti-EDN1 antibody produced in mouse

clone 3D6, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-ET1, Anti-Endothelin 1
• MDL-Nummer: MFCD00162279
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3D6, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: BC009720
• UniProt-Hinterlegungsnummer: P05305
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EDN1(1906)

Beschreibung

Allgemeine Beschreibung

Endothelin 1 (ET1) is an endothelium-derived peptide. It is synthesized as an inactive form of 212 amino acids and later converted to an active 21 amino acid peptide. The gene encoding it is localized on human chromosome 6p24.1.

Immunogen

EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW

Biochem./physiol. Wirkung

Endothelin 1 (ET1) is a vasoconstrictor and is involved in pulmonary vascular homeostasis. ET1 has been linked to HIV (human immunodeficiency virus)-associated pulmonary arterial hypertension and endothelial dysfunction.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)