WH0000993M1

Monoclonal Anti-CDC25A antibody produced in mouse

clone 3D5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-CDC25A2, Anti-cell division cycle 25A
• MDL-Nummer: MFCD01633248
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3D5, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: BC007401
• UniProt-Hinterlegungsnummer: P30304
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CDC25A(993)

Beschreibung

Allgemeine Beschreibung

CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

The cell division cycle 25A (CDC25A) is a potent human oncogene, mapped to chromosome 3p21.31. The gene codes for a member of Cdc25 phosphatase family.

Immunogen

CDC25A (AAH07401, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT

Biochem./physiol. Wirkung

Cell division cycle 25A (CDC25A) plays a crucial role at the Gl/S-phase transition. The protein also facilitates G2 arrest caused by DNA damage or in the presence of unreplicated DNA. CDC25A controls cell cycle progression by dephosphorylating and activating cyclin-CDK complexes. Elevated expression of the gene increases the G1/S and G2/M transitions, which subsequently lead to genomic instability and tumorigenesis. CDC25A expression might be associated with the pathogenesis and progression of hepatocellular carcinoma (HCC).

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)