SAB2109032

Anti-SLC6A2 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): NAT1, NET, NET1, SLC6A5
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 69 kDa
• Speziesreaktivität (Voraussage durch Homologie): human, rat, bovine, horse, guinea pig, canine, mouse, rabbit
• Konzentration: 0.5 mg/mL
• Methode(n): western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: NM_001043
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC6A2(57396)

Beschreibung

Allgemeine Beschreibung

The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.

Immunogen

Synthetic peptide directed towards the middle region of human SLC6A2

Sequenz

Synthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable