SAB2108614

Anti-GADD45B

affinity isolated antibody

• Synonym(e): Anti- MYD118
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 18 kDa
• Speziesreaktivität: bovine, human, dog, horse, pig, mouse, rat
• Konzentration: 0.5-1 mg/mL
• Methode(n): immunoblotting: suitable; immunohistochemistry: suitable
• Hinterlegungsnummer: NM_015675
• UniProt-Hinterlegungsnummer: O75293
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GADD45B(4616)

Beschreibung

Allgemeine Beschreibung

Growth arrest and DNA damage-inducible 45 (GADD45B) gene is located on human chromosome 19p13.3.

Immunogen

Synthetic peptide directed towards the middle region of human GADD45B

Biochem./physiol. Wirkung

sGrowth arrest and DNA damage-inducible 45 (GADD45B) acts as a tumor suppressor gene through p53-mediated apoptotic pathways. GADD45B helps to maintain chondrocyte homeostasis by regulating the expression of collagen gene.

Sequenz

Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable