SAB2107938

Anti-CCL5 antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 10kDa
• Speziesreaktivität: rat, human, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunoblotting: suitable
• NCBI-Hinterlegungsnummer: NM_013653
• UniProt-Hinterlegungsnummer: P30882
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: mouse ... CCL5(20304)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of mouse CCL5

Biochem./physiol. Wirkung

Recently, it has been shown that genetic polymorphisms can result in diminished expression of CCL5, which results in increased susceptibility to and progression of infectious diseases. CCL5, together with Th cytokine mRNA expression, is temporally up-regulated during pneumococcal carriage. CCL5 is an essential factor for the induction and maintenance of protective pneumococcal immunity

Sequenz

Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable