SAB2106516

Anti-DUSP11 antibody produced in rabbit

affinity isolated antibody

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 38 kDa
• Speziesreaktivität: rabbit, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_028099
• UniProt-Hinterlegungsnummer: Q6NXK5
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DUSP11(8446)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal of human DUSP11

Biochem./physiol. Wirkung

It has both, RNA 5′-diphosphatase and 5′-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to RNA. Dusp11 may participate in nuclear mRNA metabolism.

Sequenz

Synthetic peptide located within the following region: GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable