SAB1413281

Monoclonal Anti-RLF antibody produced in mouse

clone 2G2, purified immunoglobulin, buffered aqueous solution

• Synonym(e): RLF
• UNSPSC-Code: 51111800

Eigenschaften

• Konjugat: unconjugated
• Qualitätsniveau: 100
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2G2, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: 37.73 kDa
• Speziesreaktivität: human
• Konzentration: ~0.3-1 μg/μL
• Methode(n): ELISA: suitable; western blot: suitable
• Isotyp: IgG2a, kappa
• Protein-ID-Hinterlegungsnummer: NM_012421
• Versandbedingung: dry ice
• Lagertemp.: -10 to -25°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... RLF(6018)

Beschreibung

Allgemeine Beschreibung

Mouse monoclonal antibody raised against a partial recombinant RLF.

Immunogen

RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequenz

SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Angaben zur Herstellung

Purification by Protein A sepharose

Lagerung und Haltbarkeit

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable