Direkt zum Inhalt
Merck

SAB1412431

Sigma-Aldrich

ANTI-MUC2 antibody produced in mouse

clone 3D10, purified immunoglobulin, buffered aqueous solution

Synonym(e):

MLP, MUC2, SMUC

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μG
CHF 474.00

CHF 474.00


Voraussichtliches Versanddatum12. Mai 2025



Größe auswählen

Ansicht ändern
100 μG
CHF 474.00

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

CHF 474.00


Voraussichtliches Versanddatum12. Mai 2025


Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

3D10, monoclonal

Form

buffered aqueous solution

Mol-Gew.

antigen 36.63 kDa

Speziesreaktivität

human

Methode(n)

indirect ELISA: suitable

Isotyp

IgG2aκ

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... MUC2(4583)

Allgemeine Beschreibung

Mucin 2, oligomeric mucus/gel-forming (MUC2) is encoded by the gene mapped within 400kb on human chromosome 11p15.5. The encoded protein has a molecular mass of ~550 kDa and is expressed at high levels in the intestine and at lower levels in the respiratory tree. Mucin is a key component of mucus and it consists of one partial von Willebrand domain (vWD) at N- terminal and two complete domains including CysD domain and two proline, threonine and serine (PTS) domains that become densely O-glycosylated to form the prolonged mucin domains.
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Immunogen

MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*

Biochem./physiol. Wirkung

Mucin 2, oligomeric mucus/gel-forming (MUC2) acts as a major constituent of the two-layered mucous structure in the colon. MUC2 in the outer mucous layer provides the habitat for the commensal flora and in the stratified inner mucous layer it protects the epithelial cells from bacteria invasion. The encoded protein controls expression and antimicrobial activity of β-defensin 2. Deficiency of MUC2 mucin might lead to opportunistic microbial invasion and/or impaired innate responses.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

E R Cobo et al.
Mucosal immunology, 8(6), 1360-1372 (2015-04-30)
In this study we identified mechanisms at the colonic mucosa by which MUC2 mucin regulated the production of β-defensin in a proinflammatory milieu but functionally protected susceptible bacteria from its antimicrobial effects. The regulator role of MUC2 on production of
L E Vinall et al.
Human genetics, 102(3), 357-366 (1998-04-17)
A family of four genes that encode major secreted mucins (MUC6, MUC2, MUC5AC and MUC5B) map to within 400 kb on chromosome 11p15.5. These genes contain long stretches of tandem repeats of sequence that encode serine- and threonine-rich domains but
P Pigny et al.
Genomics, 38(3), 340-352 (1996-12-15)
Four distinct genes that encode mucins have previously been mapped to chromosome 11p15.5. Three of these genes (MUC2, MUC5AC, and MUC6) show a high level of genetically determined polymorphism and were analyzed in the CEPH families. Linkage analysis placed all
Sjoerd van der Post et al.
Journal of proteome research, 13(12), 6013-6023 (2014-11-19)
The polymeric mucin MUC2 constitutes the main structural component of the mucus that covers the colon epithelium. The protein's central mucin domain is highly O-glycosylated and binds water to provide lubrication and prevent dehydration, binds bacteria, and separates the bacteria
Christian V Recktenwald et al.
The Journal of biological chemistry, 291(26), 13580-13590 (2016-04-30)
The main structural component of the mucus in the gastrointestinal tract is the MUC2 mucin. It forms large networks that in colon build the loose outer mucous layer that provides the habitat for the commensal flora and the inner mucous

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.