SAB1411223

Anti-SALL2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(e): FLJ10414, FLJ55746, HSAL2, KIAA0360, ZNF795, p150(Sal2)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 20.9 kDa
• Speziesreaktivität: human
• Methode(n): western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: ENST00000317492
• UniProt-Hinterlegungsnummer: Q9Y467
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SALL2(6297)

Beschreibung

Allgemeine Beschreibung

SALL2 is a multi-zinc finger transcription factor belonging to the Drosophila homeotic spalt-like family of developmental transcription factor genes. It is expressed during the development of human retina at the time of optic fissure closure.

Immunogen

SALL2 (ENSP00000320536, 1 a.a. ~ 198 a.a) full-length human protein.

Sequence
MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA

Biochem./physiol. Wirkung

SALL2 mainly associated with the growth arrest and pro-apoptotic functions. It is involved in eye morphogenesis. Alteration in the gene function causes ocular coloboma in humans and mice. It has ability to supress the c-MYC transcription by binding to the nuclease hypersensitive element of the c-MYC promoter.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable