SAB1404444

Monoclonal Anti-TBX2, (C-terminal) antibody produced in mouse

clone 3B2, ascites fluid

• Synonym(e): FLJ10169
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: ascites fluid
• Antikörper-Produkttyp: primary antibodies
• Klon: 3B2, monoclonal
• Mol-Gew.: antigen ~37.11 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_005994
• UniProt-Hinterlegungsnummer: Q13207
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TBX2(6909)

Beschreibung

Allgemeine Beschreibung

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene. (provided by RefSeq)

Immunogen

TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK

Physikalische Form

Clear solution

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable