SAB1403506

Monoclonal Anti-MAP3K15 antibody produced in mouse

clone 1H7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): FLJ16518, bA723P2.3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1H7, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~36.67 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: NM_001001671
• UniProt-Hinterlegungsnummer: Q6ZN16
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MAP3K15(389840)

Beschreibung

Allgemeine Beschreibung

Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) belongs to the group of apoptosis signal-regulating kinases. It is expressed in the kidney and the gene encoding it is localized on human chromosome Xp22.12.

Immunogen

MAP3K15 (NP_001001671, 691 a.a. ~ 786 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD

Biochem./physiol. Wirkung

Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) modulates blood pressure in the kidney. It has a role in signal transduction cascades related to apoptotic cell death initiated due to cellular stress. ASK3 has been shown to protect HeLa cells against cytotoxicity induced by oxidative stress, antibodies or proteins.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable