SAB1403056

Monoclonal Anti-FLOT1 antibody produced in mouse

clone 4A1, ascites fluid

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: ascites fluid
• Antikörper-Produkttyp: primary antibodies
• Klon: 4A1, monoclonal
• Mol-Gew.: antigen ~37.11 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgMκ
• NCBI-Hinterlegungsnummer: NM_005803
• UniProt-Hinterlegungsnummer: O75955
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... FLOT1(10211)

Beschreibung

Allgemeine Beschreibung

Flotillin 1 (FLOT1) is an integral membrane protein and a component of lipid rafts. This estrogen responsive gene is localized on human chromosome 6p21.33.

Immunogen

FLOT1 (NP_005794.1, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI

Biochem./physiol. Wirkung

Flotillin 1 (FLOT1) has a role in endocytosis. It also functions in growth factor signaling and activates mitogen-activated protein kinase signaling. The protein has been associated with tumor progression and is expressed in many cancers.

Physikalische Form

Clear solution

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 13 - Non Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable