SAB1402786

Monoclonal Anti-GGTLA1, (C-terminal) antibody produced in mouse

clone 3E10, ascites fluid

• Synonym(e): DKFZp566O011, FLJ92733, GGT-REL, GGTLA1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: ascites fluid
• Antikörper-Produkttyp: primary antibodies
• Klon: 3E10, monoclonal
• Mol-Gew.: antigen ~34.58 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotyp: IgMκ
• NCBI-Hinterlegungsnummer: NM_004121
• UniProt-Hinterlegungsnummer: P36269
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GGT5(2687)

Beschreibung

Allgemeine Beschreibung

This gene is a member of a gene family that encodes gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn′t convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

GGTLA1 (NP_004112.1, 510 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY

Physikalische Form

Clear solution

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable