HPA009065

Anti-SOX7 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Transcription factor SOX-7
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA009065
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS
• UniProt-Hinterlegungsnummer: Q9BT81
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SOX7(83595)

Beschreibung

Allgemeine Beschreibung

SOX7 (Sex-determining region Y-box 7) is a transcription factor, which is a member of the SOX family. It belongs to the SOX F subgroup, which also contains SOX17 and SOX18. This gene is localized to human chromosome 8p23.1.

Immunogen

Transcription factor SOX-7 recombinant protein epitope signature tag (PrEST)

Anwendung

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem./physiol. Wirkung

SOX7 (Sex-determining region Y-box 7) is involved in multiple developmental events such as, hematopoiesis, endoderm differentiation, vasculogenesis, cardiogenesis and myogenesis. This gene is deleted in non-small cell lung cancer (NSCLC), and functions as a tumor suppressor in colorectal and prostate cancer. Only Sox7 is capable of transcriptionally elevating the expression of SOX4. However, this results in suppression of Sox4-meditated activation of β-catenin/TCF (transcription factor) 4-driven transcription. SOX7 also functions in a complex feedback loop where activation of SOX4 results in the inhibition of its own promoter activity. It functions as tumor suppressor through Wnt/β-catenin pathway, and inactivation in ovarian cancer leads to malignancy and tumor suppression. It suppresses hepatocarcinogenesis, and thus, might have potential as a therapeutic target.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70981

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)