Synthetic peptide directed towards the N terminal region of human ZNHIT3
Anwendung
Anti-ZNHIT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem./physiol. Wirkung
Zinc finger, HIT-type containing 3 (ZNHIT3) is a nuclear receptor interacting protein that interacts with peroxisome proliferator-activated receptor γ (PPARγ) and regulates development and homeostasis. ZNHIT3 may regulate the transcription activity of hepatocyte nuclear factor-4α and may be involved in glucose metabolism.
Sequenz
Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nuclear receptors (NRs) are major targets for drug discovery and have key roles in development and homeostasis as well as in many diseases such as obesity, diabetes, and cancer. NRs are ligand-dependent transcription factors that need to work in concert
Mutations of the hepatocyte nuclear factor-4alpha (HNF-4alpha) gene are associated with a subtype of maturity-onset diabetes of the young (MODY1) that is characterized by impaired insulin secretion in response to a glucose load. HNF-4alpha, which is a transcription factor expressed
Questions
Reviews
★★★★★ No rating value
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..