AV49411

Anti-HLA-F antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-CDA12, Anti-HLA-5.4, Anti-HLA-CDA12, Anti-HLAF, Anti-Major histocompatibility complex, class I, F
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 48 kDa
• Speziesreaktivität: pig, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_061823
• UniProt-Hinterlegungsnummer: P30511
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... HLA-F(3134)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human HLA-F

Anwendung

Anti-HLA-F antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem./physiol. Wirkung

Major histocompatibility complex, class I, F (HLA-F) is a non-classic heavy chain that forms a heterodimer with β-2 microglobulin and participates in MHC-I antigen cross-presentation pathway. HLA-F functions as a ligand for Ig-like receptors on natural killer cells that regulate the inflammatory response.

Sequenz

Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable