Synthetic peptide directed towards the C terminal region of human AADAC
Anwendung
Anti-AADAC antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem./physiol. Wirkung
Arylacetamide deacetylase (AADAC) is an esterase involved in the hydrolysis of a variety of drugs such as flutamide, phenacetin and rifamycin.
Sequenz
Synthetic peptide located within the following region: NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Drug metabolism and disposition: the biological fate of chemicals, 38(9), 1532-1537 (2010-06-15)
Phenacetin was withdrawn from the market because it caused renal failure in some patients. Many reports indicated that the nephrotoxicity of phenacetin is associated with the hydrolyzed metabolite, p-phenetidine. Acetaminophen (APAP), the major metabolite of phenacetin, is also hydrolyzed to
Drug metabolism and pharmacokinetics, 27(5), 466-477 (2012-07-21)
In this review, novel aspects of the role of esterases, which contribute to the metabolism of 10% of therapeutic drugs, are described. Esterases hydrolyze the compounds that contain ester, amide, and thioester bonds, which cause prodrug activation or detoxification. Among
Questions
Reviews
★★★★★ No rating value
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
