Direkt zum Inhalt
Merck

AV44167

Sigma-Aldrich

Anti-SLC19A1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(e):

Anti-CHMD, Anti-FOLT, Anti-IFC1, Anti-REFC, Anti-RFC1, Anti-Solute carrier family 19 (folate transporter), member 1

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μL
CHF 417.00

CHF 417.00


Check Cart for Availability
Für Ihr Target ist ein rekombinanter, konservierungsmittelfreier Antikörper verfügbar. Probieren Sie ZRB1461


Größe auswählen

Ansicht ändern
100 μL
CHF 417.00

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

CHF 417.00


Check Cart for Availability
Für Ihr Target ist ein rekombinanter, konservierungsmittelfreier Antikörper verfügbar. Probieren Sie ZRB1461

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

IgG fraction of antiserum

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

65 kDa

Speziesreaktivität

human

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

immunohistochemistry: suitable
western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... SLC19A1(6573)

Allgemeine Beschreibung

Solute carrier family 19 (folate transporter), member 1 (SLC19A1, CHMD, FOLT, RFC1, IFC1) is a major carrier-mediated transporter in mammalian cells for the uptake of reduced folates and antifolate-based anticancer drugs such as methotrexate. RFC activity can be considered as a potential marker for predicting response to antifolate chemotherapy.

Spezifität

Anti-SLC19A1 polyclonal antibody reacts with human solute carrier family 19 (folate transporter), member 1.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC19A1

Anwendung

Anti-SLC19A1 polyclonal antibody is used to tag solute carrier family 19 (folate transporter), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 19 (folate transporter), member 19 in carrier-mediated reduced folate uptake.

Biochem./physiol. Wirkung

Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].

Sequenz

Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Empfehlung

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Letter to the editor.
Gokce Gurler et al.
Neuropathology and applied neurobiology, 50(2), e12969-e12969 (2024-03-18)
Julian C Gilmore et al.
EBioMedicine, 75, 103771-103771 (2021-12-27)
Due to the critical role of folates in neurodevelopment, it is important to understand potential interactions between anti-HIV drugs used during pregnancy, and folate delivery pathways in the placenta. This study investigates the effect of dolutegravir (DTG) exposure on the
Gokce Gurler et al.
Fluids and barriers of the CNS, 20(1), 47-47 (2023-06-17)
Reduced folate carrier 1 (RFC1; SLC19a1) is the main responsible transporter for the B9 family of vitamins named folates, which are essential for normal tissue growth and development. While folate deficiency resulted in retinal vasculopathy, the expression and the role of RFC1 in
Vishal Sangha et al.
Fluids and barriers of the CNS, 21(1), 67-67 (2024-08-28)
Folates are a family of B9 vitamins essential for normal growth and development in the central nervous system (CNS). Transport of folates is mediated by three major transport proteins: folate receptor alpha (FRα), proton-coupled folate transporter (PCFT), and reduced folate
Camille Alam et al.
Molecular pharmaceutics, 14(11), 3848-3858 (2017-09-09)
Folates are essential for brain development and function. Folate transport in mammalian tissues is mediated by three major folate transport systems, i.e., reduced folate carrier (RFC), proton-coupled folate transporter (PCFT), and folate receptor alpha (FRα), known to be regulated by

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.