AV38957

Anti-AATF (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Apoptosis antagonizing transcription factor
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 63 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_036270
• UniProt-Hinterlegungsnummer: Q9NY61
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... AATF(26574)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human AATF

Biochem./physiol. Wirkung

AATF (Apoptosis antagonizing transcription factor) is a leucine zipper containing transcription factor with a strong transctivation activity. It has been reported as a nucleolar stress sensor and a cofactor that mediates c-Jun-mediated apoptosis. AATF also acts as a modulator of p53-mediated apoptosis in response to DNA damage.

Sequenz

Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable