Synthetic peptide directed towards the C terminal region of human MMP19
Biochem./physiol. Wirkung
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP′s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of the protein encoded by this gene has not been determined. This gene was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.
Sequenz
Synthetic peptide located within the following region: IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Patients with a congenital optic nerve disease, cavitary optic disc anomaly (CODA), are born with profound excavation of the optic nerve resembling glaucoma. We previously mapped the gene that causes autosomal-dominant CODA in a large pedigree to a chromosome 12q
Questions
Reviews
★★★★★ No rating value
Active Filters
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..