AV32279

Anti-TFEC antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Tfec Antibody, Tfec Antibody - Anti-TFEC antibody produced in rabbit, Anti-TCFEC, Anti-TFECL, Anti-Transcription factor EC
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 35 kDa
• Speziesreaktivität: human, rat, pig, dog
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_036384
• UniProt-Hinterlegungsnummer: Q5H9U8
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TFEC(22797)

Beschreibung

Allgemeine Beschreibung

TFEC is a basic helix-loop-helix protein that forms heterodimers with TFE3 and subsequently blocks transcriptional stimulation. TFEC may be involved in the regulation of macrophage-specific genes.
Rabbit Anti-TFEC antibody recognizes mouse, canine, bovine, rat, and human TFEC.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFEC

Anwendung

Rabbit Anti-TFEC antibody can be used for western blot applications at a concentration of 0.25μg/ml.

Biochem./physiol. Wirkung

TFEC is an activator of transcription with two separate activation domains.

Sequenz

Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable