AV02040

Anti-TNFSF10 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Tumor necrosis factor (ligand) superfamily, member 10
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 33 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_003801
• UniProt-Hinterlegungsnummer: P50591
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TNFSF10(8743)

Beschreibung

Allgemeine Beschreibung

TNFSF10 (TRAIL) is a p53 target gene that regulates p53-dependent apoptosis.
Rabbit Anti-TNFSF10 antibody binds to human, canine, and pig TNFSF10.

Immunogen

Synthetic peptide directed towards the N terminal region of human TNFSF10

Anwendung

Rabbit Anti-TNFSF10 antibody can be used for western blot assays at 1.0μg/ml.

Sequenz

Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable