SAB5702607

Anti-ESRα Antibody, clone 4L8K5, Rabbit Monoclonal

• Synonyme(s) : ESR1,ER,ESR,ESRA,ESTRR,Era,NR3A1,ER alpha
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 4L8K5, monoclonal
• Forme: liquid
• Poids mol.: 66 kDa
• Espèces réactives: human, rat, rat
• Concentration: 1.33 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:1000 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: AVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFY
• Numéro d'accès UniProt: P03372
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ESR1(2099)

Description

Description générale

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Estrogen Receptor alpha (ESRα) (P03372).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1