SAB2108453

Anti-TFEB

affinity isolated antibody

• Synonyme(s) : Anti-Math5
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 53 kDa
• Espèces réactives: horse, human, rabbit, pig, mouse, goat, bovine, rat
• Concentration: 0.5-1 mg/mL
• Technique(s): immunoblotting: suitable
• Numéro d'accès UniProt: P19484
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TFEB(7942)

Description

Description générale

Transcription factor EB (TFEB) is encoded by the gene mapped to human chromosome 6p21.1. The encoded protein belongs to the MiT transcription factor family. TFEB is widely expressed and is characterized with a transactivation domain, basic-helix-loop-helix domain, glutamine rich region, leucine zipper region and proline rich region.

Immunogène

Synthetic peptide directed towards the middle region of human TFEB

Actions biochimiques/physiologiques

Transcription factor EB (TFEB) plays a key role in the regulation of autophagy and lysosome biogenesis. TFEB, expressed in endothelial cells, reduces inflammation and hinders atherosclerosis development. Thus, this protein can be considered as a potent therapeutic target for atherosclerosis and associated cardiovascular diseases.

Séquence

Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable