SAB1402697

Monoclonal Anti-ATP1A3 antibody produced in mouse

clone 1D2, ascites fluid

• Synonyme(s) : DYT12, MGC13276, RDP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 1D2, monoclonal
• Poids mol.: antigen ~37.77 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgMκ
• Numéro d'accès NCBI: NM_152296
• Numéro d'accès UniProt: P13637
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Informations sur le gène: human ... ATP1A3(478)

Description

Description générale

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 3 subunit. (provided by RefSeq)

Immunogène

ATP1A3 (NP_689509.1, 879 a.a. ~ 984 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPY

Forme physique

Clear solution

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable