Accéder au contenu
Merck
Toutes les photos(6)

Key Documents

HPA040586

Sigma-Aldrich

Anti-PLXNB1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Kiaa0407, Anti-Plexin b1, Anti-Plxn5, Anti-Sep

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

PGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWC

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PLXNB1(5364)

Description générale

Plexin B1 (PLXNB1) gene spanning 21kb with 37 exons is mapped to human chromosome 3p21.31. The encoded protein is predominantly expressed in fetal kidney, digestive system, thyroid, prostate and trachea and is also expressed at lower levels in fetal brain, lung, female reproductive system and liver. PLXNB1 is a member of the plexin family and is characterized with a three IPT (Ig-like, plexins, transcription factors) /TIG domains and one Sema domain.

Immunogène

plexin B1 recombinant protein epitope signature tag (PrEST)

Application

Anti-PLXNB1 antibody produced in rabbit has been used in immunohistochemistry.

Actions biochimiques/physiologiques

Plexin B1 (PLXNB1) interacts with its ligand semaphorin4D (Sema4D) and induces androgen receptor (AR) transcriptional activity by stimulating translocation of AR to the nucleus. It plays a vital role in in signal transduction, intracellular signaling cascade, multicellular organismal development, cell migration, angiogenesis and positive regulation of axonogenesis. Mutation of the gene or elevated expression of the protein is associated with the pathogenesis of prostate cancer. PLXNB1 inhibits the glioma invasiveness and angiogenesis via controlling the Ras homolog gene family, member A (RhoA) /αvβ3/ phosphoinositide-3-kinase/Akt (PI3K/Akt) signaling pathway and serine-arginine protein kinase 1 (SRPK1).Thus, this protein can be considered as a potential therapeutic target for the glioma invasion and angiogenesis.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST79469

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

M Williamson et al.
Oncogene, 35(8), 1066-1072 (2015-05-20)
Semaphorins and their receptors plexins have diverse roles in many cancers affecting tumour growth, metastasis and angiogenesis. Plexin-B1, the receptor for semaphorin4D (Sema4D), has been implicated in prostate cancer where mutation of the gene and overexpression of the protein occur.
Yingwei Chang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 37(8), 11225-11236 (2016-03-06)
Gliomas are one of the most common primary brain tumors in adults. They display aggressive invasiveness, are highly vascular, and have a poor prognosis. Plexin-B1 is involved in numerous cellular processes, especially cellular migration and angiogenesis. However, the role and
Yong Huang et al.
Nature neuroscience, 27(8), 1489-1504 (2024-05-28)
Communication between glial cells has a profound impact on the pathophysiology of Alzheimer's disease (AD). We reveal here that reactive astrocytes control cell distancing in peri-plaque glial nets, which restricts microglial access to amyloid deposits. This process is governed by
Jean-Loup Huret et al.
Nucleic acids research, 41(Database issue), D920-D924 (2012-11-20)
The Atlas of Genetics and Cytogenetics in Oncology and Haematology (http://AtlasGeneticsOncology.org) is a peer-reviewed internet journal/encyclopaedia/database focused on genes implicated in cancer, cytogenetics and clinical entities in cancer and cancer-prone hereditary diseases. The main goal of the Atlas is to
Chiea Chuen Khor et al.
Nature genetics, 48(5), 556-562 (2016-04-12)
Primary angle closure glaucoma (PACG) is a major cause of blindness worldwide. We conducted a genome-wide association study (GWAS) followed by replication in a combined total of 10,503 PACG cases and 29,567 controls drawn from 24 countries across Asia, Australia

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique