Accéder au contenu
Merck
Toutes les photos(8)

Principaux documents

HPA039281

Sigma-Aldrich

Anti-DIS3 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Dis3 mitotic control homolog (S. cerevisiae), Anti-Dis3p, Anti-Exosc11, Anti-Exosome complex exonuclease RRP44, Anti-Kiaa1008, Anti-Rrp44

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

RNAi knockdown
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

Séquence immunogène

EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DIS3(22894)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

The DIS3 homolog, exosome endoribonuclease and 3′-5′ exoribonuclease (DIS3) gene, with 21 exons spanning 26.5kb of genomic DNA, is mapped to human chromosome 13q21-q22. The encoded protein is a human ortholog of yeast Dis3p. DIS3 belongs to the RNase II family and is composed of 958 amino acids. DIS3 is a catalytic subunit and is localized in the nucleus and cytoplasm. DIS3 contains a RNB domain involved in the exonucleolytic activity and an N-terminal PilT N-terminal (PIN) domain involved in the endonucleolytic activity.

Immunogène

DIS3 exosome endoribonuclease and 3′-5′ exoribonuclease

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Actions biochimiques/physiologiques

DIS3 homolog, exosome endoribonuclease and 3′-5′ exoribonuclease (DIS3) has both active exonuclease and endonucleolytic activity. The encoded protein is involved in the direct processing, turnover and surveillance of a large number of distinct RNA species.Inactivation mutations of DIS3 is associated with relapsed acute myeloid leukemia (AML). In addition, mutation of hDIS3 PilT N terminus (PIN) domain is also associated with the development of multiple myeloma (MM). Therefore, hDIS3 PIN domain can be considered as a potential target for the treatment of MM.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST81290

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A single subunit, Dis3, is essentially responsible for yeast exosome core activity.
Dziembowski A
Nature Structural and Molecular Biology, 14, 15-22 (2007)
Identification of a novel chromosome region, 13q21.33-q22.2, for susceptibility genes in familial chronic lymphocytic leukemia.
Ng D
Blood, 109, 916-925 (2007)
The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
Tomecki R
The Embo Journal, 29, 2342-2357 (2010)
The ribonuclease Dis3 is an essential regulator of the developmental transcriptome.
Hou D
BMC Genomics (2012)
Multiple myeloma-associated hDIS3 mutations cause perturbations in cellular RNA metabolism and suggest hDIS3 PIN domain as a potential drug target.
Tomecki R
Nucleic Acids Research, 42, 1270-1290 (2014)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique