HPA037837

Anti-IPMK antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Inositol polyphosphate multikinase
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA037837
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; Learn more about Antibody Enhanced Validation
• Technique(s): immunofluorescence: 0.25-2 μg/mL
• Séquence immunogène: DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD
• Numéro d'accès UniProt: Q8NFU5
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... IPMK(253430)

Description

Description générale

The gene encoding inositol polyphosphate multikinase (IPMK) enzyme is located on human chromosome 10q21.1. IPMK consists of inositol phosphate binding, nuclear localization signal, and ATP-binding kinase domain. It is a catalytically flexible enzyme and is part of intracellular signalling network.

Immunogène

inositol polyphosphate multikinase recombinant protein epitope signature tag (PrEST)

Application

Anti-IPMK antibody produced in rabbit may be used for the detection of IPMK protein in

• lymphoblasts by immunoprecipitation
• human adenocarcinogenic cell lines by western blotting
• in mouse 3T3 cells by western blotting

Actions biochimiques/physiologiques

Inositol polyphosphate multikinase (IPMK) indirectly mediates mRNA transport from nucleus to cytoplasm by mediating synthesis of phosphatidylinositol levels. IPMK interacts and stabilizes tumor necrosis factor receptor in HEK293T cells.IPMK coordinates with various signaling networks. Its deletion impairs immune response signalling pathways. Knockdown of IPMK leads to imbalance in the inositol polyphosphates. IPMK binds to tumor suppressor protein and regulates transcription and cell death. Mutation in the IPMK gene results in a truncated protein with reduced kinase activity. IPMK gene deletion or RNA interference results in cell growth inhibition. IPMK is regarded as prime target for tumor suppression. Pathology of Huntington′s disease is associated with IPMK protein depletion. In Alzheimer′s patients, low IPMK transcript levels may play a key in neurodegeneration.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST80294

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable