HPA014520

Anti-C5AR1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-C5a anaphylatoxin chemotactic receptor, Anti-C5a-R, Anti-C5aR, Anti-CD88 antigen
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA014520
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:50- 1:200
• Séquence immunogène: QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
• Numéro d'accès UniProt: P21730
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... C5AR1(728)

Description

Description générale

C5AR1 (complement component 5a receptor 1) is a G-protein coupled receptor (GPCR) belonging to the rhodopsin family. It is expressed in myeloid-lineage blood cells, as well as non-myeloid cells such as epithelial cells of bronchi and alveolus, and astrocytes. Its ligand is C5a, and binds to it through two sites of ligand-binding domain. One site binds to the C-terminal of C5a and the other site is a part of the N-terminal of C5AR1. C5AR1 along with two more receptors, C3AR and C5L2, make up the anaphylatoxin (AT) receptor family of the complement system.

Immunogène

C5a anaphylatoxin chemotactic receptor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

C5AR1 (complement component 5a receptor 1) binds to C5a, which results in G-protein dependant cellular activation. This includes rise in intracellular Ca²⁺ concentration and activation of mitogen-activated protein kinase (MAPK), PKB/Akt and phosphoinositide 3-kinase pathways. C5a is an anaphylatoxin, which has potent pro-inflammatory actions, and is involved in the pathogenesis of asthma, rheumatoid arthritis and sepsis. C5AR is involved in immunity against pathogens such as, bacteria like P. aeruginosa. It initiates their phagocytosis and degradation. It is expressed on Müller cells, which are glial cells found in eye. C5AR might be involved in the pathogenesis of retinal diseases such as, diabetic retinopathy (DR), by inducing the production of IL (interleukin)-6 and VEGF (vascular endothelial growth factor).

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72794

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)