HPA009426

Anti-DPEP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Dehydropeptidase-I, Anti-Dipeptidase 1 precursor, Anti-Microsomal dipeptidase, Anti-Renal dipeptidase, Anti-hRDP
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA009426
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: independent; recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunohistochemistry: 1:1000-1:2500; western blot: 0.04-0.4 μg/mL
• Séquence immunogène: VMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFQAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGAS
• Numéro d'accès UniProt: P16444
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... DPEP1(1800)

Description

Description générale

DPEP1 (dipeptidase 1) is a zinc-dependent metalloproteinase. It is a microsomal, membrane and renal dipeptidase. DPEP1 is a glycosyl-phosphotidylinositol anchored membrane protein and its C-terminal contains a highly hydrophobic sequence.

Immunogène

Dipeptidase 1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

DPEP1 (dipeptidase 1) plays a role in leukotriene and glutathione metabolism. Leukotriene is involved various inflammatory disorder such as, asthma, arthritis and inflammatory bowel disease. It acts on multiple peptides and antibiotics including thienamycin, penem and carbapenem derivatives. This protein is highly up-regulated in high-grade intraepithelial neoplasia (IEN) and CRC (colorectal carcinomas). This is linked with poor prognosis in CRC patients. Its expression is suppressed in Wilms′ tumours, in invasive and in situ breast lobular carcinomas and pancreatic ductal adenocarcinomas. Suppressed expression of this protein in pancreatic ductal adenocarcinoma (PDAC) is linked with poor survival, and in PDAC this protein suppresses tumor cell invasiveness. It increases chemosensitivity and acts as a prognostic marker of clinical outcome.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71249

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)