Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV46856

Sigma-Aldrich

Anti-CHIC2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-BTL, Anti-Cysteine-rich hydrophobic domain 2, Anti-MGC21173

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

19 kDa

Espèces réactives

guinea pig, human, bovine, rat, dog, mouse, horse, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_036242

Numéro d'accès UniProt

Q9UKJ5

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... CHIC2(26511)

Immunogène

Synthetic peptide directed towards the N terminal region of human CHIC2

Application

Anti-CHIC2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Actions biochimiques/physiologiques

CHIC2 (cysteine-rich hydrophobic domain 2) gene encodes for a 165 amino acid containing membrane protein that belongs to the CHIC family. CHIC2 is associated with vesicular structures and the plasma membrane, signifying that it may regulate exocytosis. CHIC2 gene is also involved in a chromosomal translocation occurring in acute myeloid leukemias.

Séquence

Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

J Cools et al.
FEBS letters, 492(3), 204-209 (2001-03-21)
We recently cloned the CHIC2 gene (previously BTL) by virtue of its involvement in a chromosomal translocation t(4;12)(q11;p13) occurring in acute myeloid leukemias. In this study we show that CHIC2 is a member of a highly conserved family of proteins

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique