Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV43971

Sigma-Aldrich

Anti-SLC35F2 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-DKFZp667H1615, Anti-FLJ13018, Anti-HSNOV1, Anti-Solute carrier family 35, member F2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

41 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_059985

Numéro d'accès UniProt

Q8IXU6

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC35F2(54733)

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC35F2

Application

Anti-SLC35F2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

Human Solute carrier family 35 member F2 (SLC35F2) is homologous to the lung squamous cell cancer-related gene, LSCC3. SLC35F2 is highly expressed in non-small cell lung cancer (NSCLC) tissue and probably has a prognostic value. Studies on lung cancer cells, H1299 indicate that this protein regulates of proliferation, migration and invasion.

Séquence

Synthetic peptide located within the following region: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Xiao Li et al.
Cancer cell international, 13(1), 73-73 (2013-07-25)
To investigate the effects of RNA interference-mediated downregulation of Human Solute Carrier Family 35 member F2 (SLC35F2) expression on the biological behavior of lung cancer H1299 cells. The lentiviral vector of small interfering RNA targeting SLC35F2 was introduced into H1299
Jing He et al.
Cancer science, 109(3), 642-655 (2017-12-24)
Solute carrier family members control essential physiological functions and are tightly linked to human diseases. Solute carrier family 35 member F2 (SLC35F2) is aberrantly activated in several malignancies. However, the biological function and molecular mechanism of SLC35F2 in papillary thyroid
Liang Bu et al.
Molecular medicine reports, 4(6), 1289-1293 (2011-08-30)
Homo sapiens solute carrier family 35 member F2 (SLC35F2) is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour
Roland Kotolloshi et al.
Cells, 10(1) (2021-01-10)
Bladder cancer is a very heterogeneous disease and the molecular mechanisms of carcinogenesis and progression are insufficiently investigated. From the DNA sequencing analysis of matched non-muscle-invasive bladder cancer (NMIBC) and muscle-invasive bladder cancer (MIBC) samples from eight patients, we identified

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique