AV42487

Anti-ASPN (AB3) antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Aporin, Anti-FLJ20129, Anti-PLAP1, Anti-SLRR1C
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 42 kDa
• Espèces réactives: human, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_060150
• Numéro d'accès UniProt: Q9BXN1
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ASPN(54829)

Description

Description générale

Asporin, periodontal ligament-associated protein 1 (PLAP1), is a member of the family of small leucine-rich proteoglycan (SLRP) family. Asporin is present in the cartilage extracellular matrix (ECM) where it plays a role in collagen mineralization. Asporin is involved in the mineralizaion of human dental pulp stem cells and predentin to dentin. Asporin inhibits bone morphogenetic protein-2 (BMP-2)-induced cytodifferentiation of periodontal ligament (PDL) cells and has been implicated in osteoarthritis.

The previously assigned protein identifier Q5TBF3 has been merged into Q9BXN1. Full details can be found on the UniProt database.

Spécificité

Anti- PLAP1 (AB3) antibody reacts with canine, mouse, chicken, human, rat, and bovine Asporin (periodontal ligament-associated protein 1) proteins.

Immunogène

Synthetic peptide directed towards the middle region of human ASPN

Application

Anti- PLAP1 (AB3) antibody is used to tag asporin proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of asporin in cartilage mineralization and cytodifferentiation of cells such as periodontal ligament (PDL) cells.

Actions biochimiques/physiologiques

ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001).[supplied by OMIM].

Séquence

Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable