HPA002279

Anti-PLVAP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : PLVAP Antibody - Anti-PLVAP antibody produced in rabbit, Plvap Antibody, Anti-Fenestrated endothelial-linked structure protein antibody produced in rabbit, Anti-PV-1 antibody produced in rabbit, Anti-Plasmalemma vesicle protein 1 antibody produced in rabbit, Anti-Plasmalemma vesicle-associated protein antibody produced in rabbit
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA002279
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunohistochemistry: 1:500-1:1000
• Séquence immunogène: KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
• Numéro d'accès UniProt: Q9BX97
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PLVAP(83483)

Description

Description générale

Plasmalemma vesicle associated protein (PLVAP) is a rod-like type II membrane amino-glycosylated glycoprotein with molecular mass of 60kDa. It consists of a short intracellular tail and a long extracellular domain. There are four glycosylation sites, a proline-rich region and two large coiled-coil domains. In culture and in situ state it exists as homodimers.

The PLVAP gene is mapped to human chromosome 19p13.11.

Immunogène

Plasmalemma vesicle-associated protein recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-PLVAP antibody produced in rabbit has been used in immunohistochemistry.

Actions biochimiques/physiologiques

PLVAP (plasmalemma vesicle associated protein) is an endothelial-specific integral membrane glycoprotein involved in the biogenesis and regulation of stomatal diaphragms of caveolae, transendothelial channels (TECs), vesiculovacuolar organelles (VVOs) and diaphragms of endothelial fenestrae. It is an endothelium-specific protein. It forms the viatl radial fibrils, a key structural component, for the stomatal diaphragm (SD) and fenestral diaphragm (FD). Studies have suggested that PLVAP dimers form fibrils of the diaphragms with microvascular permeability.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST85160

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)