Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV48224

Sigma-Aldrich

Anti-TPM2 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-AMCD1, Anti-DA1, Anti-TMSB, Anti-TropoMyosin 2 (β)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

33 kDa

Espèces réactives

human, rabbit, dog, rat, mouse, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_003280

Numéro d'accès UniProt

P07951

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TPM2(7169)

Description générale

TPM2 codes for beta-tropomyosin that belongs to the actin binding protein family. Mutations in TPM2 have been linked to congenital myopathies, Sheldon-Hall syndrome and cap disease.
Rabbit anti-TPM2 antibody recognizes canine, bovine, rabbit, zebrafish, chicken, human, mouse, and rat TPM2

Immunogène

Synthetic peptide directed towards the C terminal region of human TPM2

Application

Rabbit anti-TPM2 antibodies have been used for immunoblot analysis. It is also suitable for IHC applications at a concentration of 4-8 μg/ml.

Actions biochimiques/physiologiques

TPM2 is beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers (Tajsharghi et al., 2007 [PubMed 17846275]). See also TPM1 (MIM 191010), TPM3 (MIM 191030), and TPM4 (MIM 600317).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Séquence

Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Minttu Marttila et al.
Human mutation, 35(7), 779-790 (2014-04-03)
Mutations affecting skeletal muscle isoforms of the tropomyosin genes may cause nemaline myopathy, cap myopathy, core-rod myopathy, congenital fiber-type disproportion, distal arthrogryposes, and Escobar syndrome. We correlate the clinical picture of these diseases with novel (19) and previously reported (31)
Vilma-Lotta Lehtokari et al.
Neuromuscular disorders : NMD, 17(6), 433-442 (2007-04-17)
"Cap myopathy" or "cap disease" is a congenital myopathy characterised by cap-like structures at the periphery of muscle fibres, consisting of disarranged thin filaments with enlarged Z discs. Here we report a deletion in the beta-tropomyosin (TPM2) gene causing cap
Jung Min Ko et al.
Journal of Korean medical science, 28(5), 780-783 (2013-05-17)
Sheldon-Hall syndrome (SHS) is a rare autosomal dominant, inherited arthrogryposis syndrome characterized by multiple congenital contractures of the distal limbs. To date, four genes that encode the skeletal muscle fiber complex have been confirmed as the causative genes. Mutations in
Carole L Moncman et al.
Experimental cell research, 319(3), 23-31 (2012-11-24)
Extraocular muscles are a unique subset of striated muscles. During postnatal development, the extraocular muscles undergo a number of myosin isoform transitions that occur between postnatal day P10 (P10) and P15. These include: (1) loss of embryonic myosin from the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique