Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Documents

WH0007001M1

Sigma-Aldrich

Monoclonal Anti-PRDX2 antibody produced in mouse

clone 4E10-2D2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-MGC4104, Anti-NKEFB, Anti-PRP, Anti-PRXII, Anti-Peroxiredoxin 2, Anti-TDPX1, Anti-TSA

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(6)

About This Item

Numéro MDL:
MFCD00162725
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4E10-2D2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

BC000452

Numéro d'accès UniProt

P32119

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PRDX2(7001)

Description générale

Peroxiredoxin 2 (PRDX2) is an antioxidant protein that belongs to the peroxiredoxins family. It is associated with mammalian erythrocytes. The PRDX2 gene is mapped to human chromosome19p13.13.

Immunogène

PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Application

Monoclonal Anti-PRDX2 antibody produced in mouse has been used in western blotting (1:1000).

Actions biochimiques/physiologiques

Peroxiredoxin 2 (PRDX2) effectively neutralizes hydrogen peroxide (H2O2 ). It is regarded as a critical cell survival modulator and may serve as a key regulator for cell proliferation and intracellular signaling. Downregulated expression of PRDX2 is observed in acute myeloid leukemia (AML) and melanoma. However, it acts as an oncogene in the pathophysiology of various cancers including non-small cell lung cancer (NSCLC), esophageal, cervical, gastric tumors, and many more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ting Duan et al.
Molecular medicine reports, 13(6), 4807-4813 (2016-04-16)
Late‑onset hypogonadism is defined as a condition caused by a decline in the levels of testosterone with aging. One of the major factors contributing to the low levels of testosterone is the accumulation of reactive oxygen species (ROS) in Leydig
Kumarasamypet M Mohankumar et al.
Nature genetics, 47(8), 878-887 (2015-06-16)
Cancers are characterized by non-random chromosome copy number alterations that presumably contain oncogenes and tumor-suppressor genes (TSGs). The affected loci are often large, making it difficult to pinpoint which genes are driving the cancer. Here we report a cross-species in
Yun Chen et al.
BioMed research international, 2020, 8359860-8359860 (2020-09-11)
Previous studies have reported that the levels of PRDX2 were correlated with tumorigenicity, recurrence, and prognosis of patients with different cancers. We investigated the association between PRDX2 levels and the prognosis of lung cancer patients. We also measured PRDX2 expression
Trung Nghia Vo et al.
Antioxidants (Basel, Switzerland), 10(7) (2021-07-03)
Hydrogen peroxide (H2O2) is a key redox signaling molecule that selectively oxidizes cysteines on proteins. It can accomplish this even in the presence of highly efficient and abundant H2O2 scavengers, peroxiredoxins (Prdxs), as it is the Prdxs themselves that transfer
Ting Luo et al.
Redox biology, 46, 102066-102066 (2021-08-03)
Hydrogen peroxide (H2O2) acts as a signalling molecule by oxidising cysteine thiols in proteins. Recent evidence has established a role for cytosolic peroxiredoxins in transmitting H2O2-based oxidation to a multitude of target proteins. Moreover, it is becoming clear that peroxiredoxins
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique