Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

SAB1402307

Sigma-Aldrich

Monoclonal Anti-PGK1, (C-terminal) antibody produced in mouse

clone 2H4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MGC117307, MGC142128, MGC8947, MIG10, PGKA

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
715,00 $

715,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
715,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

715,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2H4, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~36.41 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PGK1(5230)

Description générale

The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. (provided by RefSeq) Phosphoglycerate kinase 1 (PGK1) is a glycolytic enzyme. The gene encoding it is localized on human chromosome X.

Immunogène

PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

Actions biochimiques/physiologiques

Phosphoglycerate kinase 1 (PGK1) converts 1, 3-diphosphoglycerate to 3-phosphoglycerate. Mitochondrial PGK1 phosphorylates pyruvate dehydrogenase kinase 1. PGK1 may have a role in rheumatoid arthritis. The protein is upregulated in various cancers. It is regulated by hypoxia-inducible factor-1α. It also has a role in DNA repair and angiogenesis. Deficiency of the enzyme is linked to combinations of hemolytic anemia, neurological dysfunction and myopathy.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
Tamai M
International Journal of Hematology (2014)
PGK1, a glucose metabolism enzyme, may play an important role in rheumatoid arthritis.
Zhao Y
Inflammation Research (2016)
Refinement of Linkage of Human Severe Combined
Immunodeficiency (SCIDX I) to Polymorphic Markers in Xq 1 3
Jennifer M. Puck
American Journal of Human Genetics (1993)
Mitochondria-Translocated PGK1 Functions as a Protein Kinase to Coordinate Glycolysis and the TCA Cycle in Tumorigenesis.
Li X
Molecular Cell (2016)
Phosphoglycerate kinase-1 is a predictor of poor survival and a novel prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
Sun S
British Journal of Cancer (2015)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique