MSQC4
SILu™Lite SigmaMAb Universal Antibody Standard human
Synonyme(s) :
IgG1 light, Mass Spectrometry Universal Antibody Standard, SILu™Lite SigmaMAb Universal Antibody Standard human, recombinant IgG1 lambda light antibody, SigmaMAb
Sélectionner une taille de conditionnement
431,00 $
Sélectionner une taille de conditionnement
About This Item
431,00 $
Produits recommandés
Produit recombinant
expressed in CHO cells
Niveau de qualité
Conditions d'expédition
wet ice
Température de stockage
−20°C
Description générale
It consists of two identical heavy chains and two identical light chains. The heavy chains and light chains are linked by one disulfide bond. The heavy chains are linked by two disulfide bonds located in a hinge domain. The other 12 cysteine bonds are intramolecularly restricted to six different globular domains. The antibody sequence has been evaluated by intact mass and peptide mapping using four different enzymes: chymotrypsin, Asp-N and Glu-C endoproteinases and trypsin. Sequence coverage of 100% was obtained.
Application
Caractéristiques et avantages
Description / Composition / Modification / Average Mass (Da)
Light chain, reduced / C1006H1555N267O333S7 / Pyroglutamic acid (Q) / 22942.2
Heavy chain, reduced / C2181H3393N587O663S16 / (no modification) / 48957.8
C2237H3485N591O702S16 / G0F / 50403.2
C2243H3495N591O707S16 / G1F / 50565.3
C2249H3505N591O712S16 / G2F / 50727.5
Native intact mass, non-reduced / C6374H9864N1708O1992S46 / 2 X Pyroglutamic acid (Q) / 143767.7
C6486H10048N1716O2070S46 / G0F+G0F / 146658.4
C6492H10058N1716O2075S46 / G0F+G1F / 146820.6
C6498H10068N1716O2080S46 / G1F+G1F / 146982.7
C6504H10078N1716O2085S46 / G1F+G2F / 147144.8
C6510H10088N1716O2090S46 / G2F+G2F / 147307.0
Forme physique
Notes préparatoires
Remarque sur l'analyse
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Autres remarques
Reconstitute the contents of the vial by adding 500μL of ultrapure water or phosphate buffer, and mixing vigorously. The solubilized product can be further diluted as needed.
Informations légales
Produit(s) apparenté(s)
Supplément
Code de la classe de stockage
11 - Combustible Solids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Les clients ont également consulté
Articles
Residual presence of host cell proteins (HCPs) in recombinant therapeutic products has considerable clinical safety risks associated with a potential immunological response in patients.
Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.
Compare columns in resolving medium-sized antibody fragments after digestion with DTT or IdeS using Reversed-Phase Chromatography for analysis.
Intact analysis of Universal Antibody Standard human and Antibody-Drug Conjugate (ADC) Mimic on silica monolithic HPLC columns under various conditions.
Protocoles
SigmaMab Antibody Drug Conjugate Mimic, is a non-toxic drug mimic utilized as a standard for mass spectrometry and high performance liquid chromatography.
Here we show how LC and MS methods may be optimized using a non-toxic surrogate of the ADC, an “ADC-mimic”, that behaves very similarly to the Cys-linked ADC Adcetris (Seattle Genetics).
BIOshell™ IgG 1000 Å C4 UHPLC Column for Improved Biomacromolecule Separations
Contenu apparenté
Découvrez notre grande variété de produits pour l'analyse de la masse intacte des anticorps monoclonaux, notamment des colonnes d'exclusion stérique (SEC), des colonnes à échange d'ions, des colonnes de phase inverse, des tampons de HPLC, des matrices et étalons MALDI, des solvants de haute pureté, des réactifs, des outils pour la préparation des échantillons de protéines et des matériaux de référence certifiés.
Discover our wide variety of products for intact mass analysis of monoclonal antibodies, including size-exclusion columns (SEC), ion exchange columns, reverse-phase columns, HPLC buffers, MALDI matrices and standards, high-purity solvents, reagents, tools for protein sample preparation, and certified reference materials.
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique