Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

M1882

Sigma-Aldrich

Myoglobin from equine heart

Myoglobin from equine heart
1 of 1 reviewers received a sample product or took part in a promotion

≥90% (SDS-PAGE), essentially salt-free, lyophilized powder

Synonyme(s) :

Myoglobin from horse heart

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro CAS:
Numéro CE :
Numéro MDL:
Code UNSPSC :
12352202
Nomenclature NACRES :
NA.61
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

equine heart

Niveau de qualité

Essai

≥90% (SDS-PAGE)

Forme

essentially salt-free, lyophilized powder

Teneur en fer

≥0.20%

Technique(s)

MALDI-MS: suitable

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

horse ... MB(100054434)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Application

Myoglobin from equine heart is suitable for use in:
  • spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
  • the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
  • the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
  • a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
  • a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]

Actions biochimiques/physiologiques

Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, type N95 (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
Laurent Marichal et al.
Langmuir : the ACS journal of surfaces and colloids, 36(28), 8218-8230 (2020-06-26)
Protein adsorption on nanoparticles is an important field of study, particularly with regard to nanomedicine and nanotoxicology. Many factors can influence the composition and structure of the layer(s) of adsorbed proteins, the so-called protein corona. However, the role of protein
Brandye M Smith et al.
Analytical chemistry, 74(16), 4076-4080 (2002-08-30)
The application of single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy was investigated for secondary structure analysis of 15 representative proteins in H2O solution. This is the first reported application of single-pass ATR-FT-IR for protein analysis; thus, the method
V Kery et al.
The Journal of biological chemistry, 269(41), 25283-25288 (1994-10-14)
The first committed step of transsulfuration is catalyzed by cystathionine beta-synthase (CBS), a known pyridoxal 5'-phosphate (PLP) enzyme. The inferred amino acid sequences of rat liver CBS and rat liver hemoprotein H-450 are identical. We now confirm the presence of

Articles

Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.

Chromatograms

application for HPLC

Questions

1–7 of 7 Questions  
  1. Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?

    1 answer
    1. This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.

      Helpful?

  2. Do you have the sequence for Product M1882, Myoglobin from equine heart?

    1 answer
    1. Product M1882 - Myoglobin from equine heart is purified from equine heart.  It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service

      Helpful?

  3. What is the Department of Transportation shipping information for this product?

    1 answer
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

  4. Is Product M1882, Myoglobin from equine heart, oxidized?

    1 answer
    1. Yes, it is oxidized.

      Helpful?

  5. Is Product M1882, Myoglobin from equine heart, metmyoglobin?

    1 answer
    1. The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.

      Helpful?

  6. Which has more affinity for oxygen, hemoglobin or myoglobin?

    1 answer
    1. The affinity of myoglobin for oxygen is higher than that of hemoglobin.

      Helpful?

  7. What is the molecular weight of Product M1882, Myoglobin from equine heart?

    1 answer
    1. Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.

      Helpful?

Reviews

1 of 1 reviewers received a sample product or took part in a promotion

Active Filters

  1. New York
    • Review 1
    • Votes 0
    4 out of 5 stars.

    Is the myoglobin from equine heart dispersive in water?
    Or what are the solvent where it is dispersive.

    Helpful?

    1. Response from MilliporeSigma:

      Thank you for your review. We encourage customers who experience problems with our products to call or email us for additional technical support. Please visit https://www.sigmaaldrich.com/US/en/support/customer-support to submit a Product Technical Inquiry.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique