HPA015475
Anti-NOX4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-KOX-1, Anti-Kidney superoxide-producing NADPH oxidase, Anti-NADPH oxidase 4, Anti-Renal NAD(P)H-oxidase
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
Technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... NOX4(50507)
Description générale
NOX4 (NADPH oxidase 4) belongs to the NOX family of proteins, and is the major member of this family to be expressed in human brain pericytes. It is also highly expressed in kidney, endothelial and vascular smooth muscle cells. It resides in mitochondrial membrane and endoplasmic reticulum (ER). It is a transmembrane protein, which contains two heme groups, and its C-terminal contains flavin adenine dinucleotide and NADPH-binding domains.
Immunogène
NADPH oxidase 4 recombinant protein epitope signature tag (PrEST)
Application
Anti-NOX4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry[1] against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Actions biochimiques/physiologiques
NOX4 (NADPH oxidase 4) is involved in the growth and proliferation of human brain pericytes. It is activated by hypoxia and angiotensin II, and is responsible for the production of reactive oxygen species (ROS) in brain pericyte membranes, in an NAD(P)H-dependent manner. It might be one of the factors involved in the pathogenesis of cardiovascular disorders. It is involved in pathogen elimination, where NOX-4-produced ROS, by phagocytes, facilitates autophagy. This also determines the survival of vascular and tumor cells. In hypoxic conditions, this protein facilitates erythropoietin secretion in kidney. It has cardioprotective role during energy crisis, and this is achieved by the activation of Nox4/PERK/eIF-2α/ATF4 signaling cascade. NOX4-produced ROS also regulates the activation of redox-sensitive pathways, which in turn determines the replication of Influenza virus in the epithelial cells of lungs.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST73209
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Lot/Batch Number
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Sebastiano Sciarretta et al.
Circulation research, 113(11), 1253-1264 (2013-10-02)
Autophagy is an essential survival mechanism during energy stress in the heart. Oxidative stress is activated by energy stress, but its role in mediating autophagy is poorly understood. NADPH oxidase (Nox) 4 is an enzyme that generates reactive oxygen species
Nicole M Fletcher et al.
Reproductive sciences (Thousand Oaks, Calif.), 21(9), 1145-1152 (2014-02-13)
Uterine fibroids are the most common benign tumor in women. The goal of this study was to investigate whether nicotinamide adenine dinucleotide phosphate oxidase (NOX), a major source of superoxide and subsequent oxidative stress, was differentially regulated in myometrium versus
Donatella Amatore et al.
Cellular microbiology, 17(1), 131-145 (2014-08-27)
An overproduction of reactive oxygen species (ROS) mediated by NADPH oxidase 2 (NOX2) has been related to airway inflammation typical of influenza infection. Virus-induced oxidative stress may also control viral replication, but the mechanisms underlying ROS production, as well as
N M Fletcher et al.
Reproductive sciences (Thousand Oaks, Calif.), 21(8), 1050-1059 (2014-02-12)
We have previously reported that superoxide (O2•-) contributes to the development of postoperative adhesions. In this study, we determined whether O2•- generating nicotinamide adenine dinucleotide phosphate oxidase (NOX) is differentially expressed in normal peritoneal and adhesion fibroblasts and tissues. The
Zhongliang Jiang et al.
Gynecologic oncology, 122(2), 418-423 (2011-05-31)
Epithelial ovarian cancer (EOC) cells are known to be resistant to apoptosis through a mechanism that may involve alteration in their redox balance. NADPH oxidase is a major source of intracellular superoxide, which is converted to the less toxic product
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique
