Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV45366

Sigma-Aldrich

Anti-PTPRA antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-HEPTP, Anti-HLPR, Anti-HPTPA, Anti-HPTPalpha, Anti-LRP, Anti-PTPA, Anti-PTPRL2, Anti-Protein tyrosine phosphatase, receptor type, A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
658,00 $

658,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
658,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

658,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

89 kDa

Espèces réactives

rabbit, rat, human, bovine, guinea pig, dog, horse, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PTPRA(5786)

Immunogène

Synthetic peptide directed towards the C terminal region of human PTPRA

Application

Anti-PTPRA (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

Protein tyrosine phosphatase, receptor type A (PTPRA; R-PTPalpha) is a member of protein tyrosine phosphatase (PTP) family involved in cell growth, differentiation and mitosis. PTPRA dephosphorylates Src kinases and regulates integrin signaling involved in cell adhesion and proliferation.

Séquence

Synthetic peptide located within the following region: SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nathalie Vacaresse et al.
The Journal of biological chemistry, 283(51), 35815-35824 (2008-10-25)
Src family tyrosine kinases (SFKs) function in multiple signaling pathways, raising the question of how appropriate regulation and substrate choice are achieved. SFK activity is modulated by several protein-tyrosine phosphatases, among which RPTPalpha and SHP2 are the best established. We
Tony Tiganis et al.
The Biochemical journal, 402(1), 1-15 (2007-01-24)
It is now well established that the members of the PTP (protein tyrosine phosphatase) superfamily play critical roles in fundamental biological processes. Although there has been much progress in defining the function of PTPs, the task of identifying substrates for

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique