WH0083881M2

Monoclonal Anti-MIXL1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-MGC138179, Anti-MILD1, Anti-MIXL, Anti-Mix1 homeobox-like 1 (Xenopus laevis)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4D11, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgGκ
• nº de adesão GenBank: NM_031944
• nº de adesão UniProt: Q9H2W2
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... MIXL1(83881)

Descrição

Descrição geral

Mix paired-like homeobox, also known as mesoderm inducer in Xenopus like 1 (MIXL1), is a homeobox transcription factor. It is induced by the transforming growth factor-β family of ligands. MIXL1 is expressed in hematopoietic stem cells and progenitor cells. The gene encoding it is localized on human chromosome 1q42.12.

Imunogênio

MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP

Ações bioquímicas/fisiológicas

Mesoderm inducer in Xenopus like 1 (MIXL1) is crucial for specification of the mesoderm and endoderm during early embryogenesis. It modulates the proto-oncogene c-REL. The protein may have a role in acute myelogenous leukemia.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)