WH0051232M1

Monoclonal Anti-CRIM1 antibody produced in mouse

clone 6E4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-S52, Anti-cysteine-rich motor neuron 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 6E4, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_016441
• nº de adesão UniProt: Q9NZV1
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CRIM1(51232)

Descrição

Descrição geral

The gene encoding cysteine-rich motor neuron 1 (CRIM1) is localized on human chromosome 2p21. It is a putative transmembrane protein which possesses an insulin-like growth factor (IGF)-binding protein motif and multiple cysteine-rich repeats. CRIM1 is an antagonist of bone morphogenetic proteins. The CRIM1 gene encodes a type I transmembrane protein that is mainly expressed in angiogenic endothelial cells.

Imunogênio

CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI

Aplicação

Monoclonal Anti-CRIM1 antibody produced in mouse has been used in Western blotting.

Ações bioquímicas/fisiológicas

Cysteine-rich motor neuron 1 (CRIM1) may interact with growth factors implicated in motor neuron differentiation and survival. It may have a role in the development of the central nervous system (CNS). CRIM1 influences the adhesion and migration of cancer cells. It modulates the maturation of bone morphogenetic preprotein.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)