Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

WH0007291M1

Sigma-Aldrich

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-ACS3, Anti-BPES2, Anti-BPES3, Anti-SCS, Anti-TWIST, Anti-twist homolog 1 (acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μG
R$ 4.090,00

R$ 4.090,00


Check Cart for Availability
Um anticorpo recombinante, sem conservantes, está disponível para seu alvo. Tente ZRB1203


Selecione um tamanho

Alterar visualização
100 μG
R$ 4.090,00

About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

R$ 4.090,00


Check Cart for Availability
Um anticorpo recombinante, sem conservantes, está disponível para seu alvo. Tente ZRB1203

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3E11, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TWIST1(7291)

Categorias relacionadas

Descrição geral

Twist family bHLH transcription factor 1 (TWIST1) is a basic helix-loop-helix transcription factor and the gene encoding it is localized on human chromosome 7p21.1.

Imunogênio

TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Ações bioquímicas/fisiológicas

Twist family bHLH transcription factor 1 (TWIST1) has a role in the determination of cell lineage and differentiation during embryogenesis. During the development of neural crest, it is also involved in modulating cell movement and tissue reorganization. Mutations in the TWIST1 gene have been associated with Saethre-Chotzen syndrome (4) and the protein is also linked to various cancers.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Prognostic and clinicopathological value of Twist expression in breast cancer: A meta-analysis.
Qiao W
PLoS ONE (2017)
MACC1 ? more than metastasis?
Facts and predictions about a novel gene
Ulrike Stein
Journal of Molecular Medicine (2010)
Reactivation of TWIST1 contributes to Ewing sarcoma metastasis.
Pediatric Blood & Cancer (2018)
Saethre-Chotzen syndrome caused by TWIST 1 gene mutations: functional differentiation from Muenke coronal synostosis syndrome.
Kress W
European Journal of Human Genetics (2006)
Ping Fan et al.
European journal of cancer (Oxford, England : 1990), 50(2), 457-468 (2013-11-05)
Our publications demonstrate that physiological concentrations of oestrogen (E2) induce endoplasmic reticulum and oxidative stress which finally result in apoptosis in E2-deprived breast cancer cells, MCF-7:5C. c-Src is involved in the process of E2-induced stress. To mimic the clinical administration

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica